PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_26810-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 303aa    MW: 32608 Da    PI: 7.916
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_26810-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.1e-12549347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +W++eE++ ++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
  TRIUR3_26810-P1  5 SWSEEEHKNFLLGLNKLGKGDWRGISRNYVVSRTPTQVASHAQKY 49
                     7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.95154IPR017930Myb domain
SMARTSM007175.5E-9252IPR001005SANT/Myb domain
TIGRFAMsTIGR015575.0E-17453IPR006447Myb domain, plants
PfamPF002492.3E-10549IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-9548IPR009057Homeodomain-like
SuperFamilySSF466891.48E-14555IPR009057Homeodomain-like
CDDcd001671.53E-8550No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MASESWSEEE HKNFLLGLNK LGKGDWRGIS RNYVVSRTPT QVASHAQKYF IRQTNVNRRK  60
RRSSLFDMVI EDPGDQPLSR SSSQEMPLSR SSSQDVEEFV DDLRPVTAPV TPPAPMPVIT  120
SVSVPPPVPV MAPPAPVPML TYASAPSPVL AMAHQPQGNE SAGSSSIAGE AGMVMPQVMP  180
PYGYPPPMMI PAPHYVQAVF PYPYYGYAPM FYGPPVSMQA SSPVTVQASH EPVRPVAVHS  240
APPVNVEDLY NMSKLNLKGD SSTSGVAPNL ALPPNPNGRP ERQSAFHGKG AENGSSNGLI  300
PTK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519520.0JF951952.1 Triticum carthlicum clone TaMYB69 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573373.11e-132PREDICTED: uncharacterized protein LOC100834934
TrEMBLM8A0U60.0M8A0U6_TRIUA; Transcription factor MYB1R1
STRINGMLOC_55748.11e-179(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129002629
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-27MYB_related family protein